Ssbp1 (NM_212468) Mouse Recombinant Protein
CAT#: TP501027
Purified recombinant protein of Mouse single-stranded DNA binding protein 1 (Ssbp1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201027 representing NM_212468
Red=Cloning site Green=Tags(s) MFRRPVLQVFRQFVRHESEVASSLVLERSLNRVQLLGRVGQDPVMRQVEGKNPVTIFSLATNEMWRSGDS EVYQMGDVSQKTTWHRISVFRPGLRDVAYQYVKKGARIFVEGKVDYGEYMDKNNVRRQATTIIADNIIFL SDQTKEKA myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 17.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_997633 |
Locus ID | 381760 |
UniProt ID | Q9CYR0, Q8R2K3 |
Refseq Size | 1489 |
Cytogenetics | 6 B1 |
Refseq ORF | 444 |
Synonyms | 2810480P10Rik; G630031O20Rik; mtDBP; MtSSB |
Summary | This protein binds preferentially and cooperatively to ss-DNA. Probably involved in mitochondrial DNA replication. Associates with mitochondrial DNA (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |