Grp (NM_175012) Mouse Recombinant Protein

CAT#: TP500979

Purified recombinant protein of Mouse gastrin releasing peptide (Grp), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR200979 protein sequence
Red=Cloning site Green=Tags(s)

MRGSELSLLLLALVLCQAPRGPAAPVSTGAGGGTVLAKMYPRGSHWAVGHLMGKKSTDESPSLYAADRDG
LKEQLRGYVRWEEAARDLLDLLEAAGNQSHQPPQHPPLSLQPTWDPEDGSYFNDVQTAKLVDSLLQVLKE
KGGTAS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 15.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_778177
Locus ID 225642
UniProt ID Q8R1I2
Refseq Size 912
Cytogenetics 18 38.98 cM
Refseq ORF 441
Synonyms B; BLP
Summary This gene encodes a neuropeptide hormone that affects various biological processes such as neuroendocrine regulation, gastrointestinal secretion, nociception, cell proliferation and inflammation. The encoded protein undergoes proteolytic processing to generate multiple mature peptides with biological activity. [provided by RefSeq, Aug 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...