Cox20 (NM_025511) Mouse Recombinant Protein
CAT#: TP500523
Purified recombinant protein of Mouse cytochrome c oxidase assembly protein 20 (Cox20), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200523 representing NM_025511
Red=Cloning site Green=Tags(s) MAAAPEPHETEKKPFKLLGILDVENTPCARESILYGSLGSIVTGLGHFLVTSRIRRSCDVGVGGFILVTL GCWFHCRYNFAKQRIQERIAREGIKNKILYESTHLDPERKMKTNNSS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 13.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079787 |
Locus ID | 66359 |
UniProt ID | Q9D7J4 |
Refseq Size | 448 |
Cytogenetics | 1 H4 |
Refseq ORF | 351 |
Synonyms | 2310005N03Rik; Fam36a |
Summary | Essential for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. Acts as a chaperone in the early steps of cytochrome c oxidase subunit II (MT-CO2/COX2) maturation, stabilizing the newly synthesized protein and presenting it to metallochaperones SCO1/2 which in turn facilitates the incorporation of the mature MT-CO2/COX2 into the assembling CIV holoenzyme.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |