SHTN1 (NM_018330) Human Recombinant Protein
CAT#: TP323326
Recombinant protein of human KIAA1598 (KIAA1598), transcript variant 2, 20 µg
View other "SHTN1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223326 representing NM_018330
Red=Cloning site Green=Tags(s) MNSSDEEKQLQLITSLKEQAIGEYEDLRAENQKTKEKCDKIRQERDEAVKKLEEFQKISHMVIEEVNFMQ NHLEIEKTCRESAEALATKLNKENKTLKRISMLYMAKLGPDVITEEINIDDEDSTTDTDGAAETCVSVQC QKQIKELRDQIVSVQEEKKILAIELENLKSKLVEVIEEVNKVKQEKTVLNSEVLEQRKVLEKCNRVSMLA VEEYEEMQVNLELEKDLRKKAESFAQEMFIEQNKLKRQSHLLLQSSIPDQQLLKALDENAKLTQQLEEER IQHQQKVKELEEQLENETLHKEIHNLKQQLELLEEDKKELELKYQNSEEKARNLKHSVDELQKRVNQSEN SVPPPPPPPPPLPPPPPNPIRSLMSMIRKRSHPSGSGAKKEKATQPETTEEVTDLKRQAVEEMMDRIKKG VHLRPVNQTARPKTKPESSKGCESAVDELKGILASQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060800 |
Locus ID | 57698 |
UniProt ID | A0MZ66 |
Refseq Size | 3415 |
Cytogenetics | 10q25.3 |
Refseq ORF | 1368 |
Synonyms | KIAA1598; shootin-1 |
Summary | Involved in the generation of internal asymmetric signals required for neuronal polarization and neurite outgrowth. Mediates netrin-1-induced F-actin-substrate coupling or 'clutch engagement' within the axon growth cone through activation of CDC42, RAC1 and PAK1-dependent signaling pathway, thereby converting the F-actin retrograde flow into traction forces, concomitantly with filopodium extension and axon outgrowth. Plays a role in cytoskeletal organization by regulating the subcellular localization of phosphoinositide 3-kinase (PI3K) activity at the axonal growth cone. Plays also a role in regenerative neurite outgrowth. In the developing cortex, cooperates with KIF20B to promote both the transition from the multipolar to the bipolar stage and the radial migration of cortical neurons from the ventricular zone toward the superficial layer of the neocortex. Involved in the accumulation of phosphatidylinositol 3,4,5-trisphosphate (PIP3) in the growth cone of primary hippocampal neurons.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413126 | KIAA1598 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC426712 | KIAA1598 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413126 | Transient overexpression lysate of KIAA1598 (KIAA1598), transcript variant 2 |
CNY 4,840.00 |
|
LY426712 | Transient overexpression lysate of KIAA1598 (KIAA1598), transcript variant 1 |
CNY 3,080.00 |
|
PH323326 | KIAA1598 MS Standard C13 and N15-labeled recombinant protein (NP_060800) |
CNY 19,520.00 |
|
PH326044 | KIAA1598 MS Standard C13 and N15-labeled recombinant protein (NP_001120683) |
CNY 14,250.00 |
|
TP326044 | Purified recombinant protein of Homo sapiens KIAA1598 (KIAA1598), transcript variant 1, 20 µg |
CNY 2,900.00 |