TCF23 (NM_175769) Human Recombinant Protein
CAT#: TP321910
Recombinant protein of human transcription factor 23 (TCF23), 20 µg
View other "TCF23" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221910 representing NM_175769
Red=Cloning site Green=Tags(s) MSQRKARGPPAMPGVGHSQTQAKARLLPGADRKRSRLSRTRQDPWEERSWSNQRWSRATPGPRGTRAGGL ALGRSEASPENAARERSRVRTLRQAFLALQAALPAVPPDTKLSKLDVLVLAASYIAHLTRTLGHELPGPA WPPFLRGLRYLHPLKKWPMRSRLYAGGLGYSDLDSTTASTPSQRTRDAEVGSQVPGEADALLSTTPLSPA LGDK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_786951 |
Locus ID | 150921 |
UniProt ID | Q7RTU1 |
Refseq Size | 645 |
Cytogenetics | 2p23.3 |
Refseq ORF | 642 |
Synonyms | bHLHa24; OUT; TCF-23 |
Summary | The gene encodes a member of the basic helix-loop-helix transcription factor family. Studies of the orthologous gene in mouse have shown the encoded protein does not bind DNA but may negatively regulate other basic helix-loop-helix factors via the formation of a functionally inactive heterodimeric complex. [provided by RefSeq, May 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406221 | TCF23 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406221 | Transient overexpression lysate of transcription factor 23 (TCF23) |
CNY 3,080.00 |
|
PH321910 | TCF23 MS Standard C13 and N15-labeled recombinant protein (NP_786951) |
CNY 19,520.00 |