SSBP4 (NM_001009998) Human Recombinant Protein
CAT#: TP318268
Recombinant protein of human single stranded DNA binding protein 4 (SSBP4), transcript variant 2, 20 µg
View other "SSBP4" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218268 representing NM_001009998
Red=Cloning site Green=Tags(s) MYAKGGKGSAVPSDSQAREKLALYVYEYLLHIGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDL YCAAPDRREACEHSGEAKAFQDYSAAAAPSPVMGSMAPGDTMAAGSMAAGFFQPFMSPRFPGGPRPTLRM PSQPPAGLPGSQPLLPGAMEPSPRAQGHPSMGGPMQRVTPPRGMASVGPQSYGGGMRPPPNSLAGPGLPA MNMGPGVRGPWASPSGNSIPYSSSSPGSYTGPPGGGGPPGTPIMPSPGDSTNSSENMYTIMNPIGQGAGR ANFPLGPGPEGPMAAMSAMEPHHVNGSLGSGDMDGLPKSSPGAVAGLSNAPGTPRDDGEMAAAGTFLHPF PSESYSPGMTMSV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001009998 |
Locus ID | 170463 |
UniProt ID | Q9BWG4 |
Refseq Size | 1818 |
Cytogenetics | 19p13.11 |
Refseq ORF | 1089 |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409995 | SSBP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423175 | SSBP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409995 | Transient overexpression lysate of single stranded DNA binding protein 4 (SSBP4), transcript variant 1 |
CNY 3,080.00 |
|
LY423175 | Transient overexpression lysate of single stranded DNA binding protein 4 (SSBP4), transcript variant 2 |
CNY 3,080.00 |
|
PH300988 | SSBP4 MS Standard C13 and N15-labeled recombinant protein (NP_116016) |
CNY 14,250.00 |
|
PH318268 | SSBP4 MS Standard C13 and N15-labeled recombinant protein (NP_001009998) |
CNY 19,520.00 |
|
TP300988 | Recombinant protein of human single stranded DNA binding protein 4 (SSBP4), transcript variant 1, 20 µg |
CNY 2,900.00 |