C17orf76 (LRRC75A) (NM_207387) Human Recombinant Protein
CAT#: TP317603
Recombinant protein of human chromosome 17 open reading frame 76 (C17orf76), transcript variant 2, 20 µg
View other "C17orf76" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217603 representing NM_207387
Red=Cloning site Green=Tags(s) MGTRQTKGSLAERASPGAAPGPRRERPDFWASLLLRAGDKAGRAGAGMPPYHRRVGMVQELLRMVRQGRR EEAGTLLQHLRQDLGMESTSLDDVLYRYASFRNLVDPITHDLIISLARYIHCPKPPQGCPGRKPPRQHSG PVGNPTDLPRPGAGDQLPTALWGAGRQRGAGLHRPHGRHGPAAAASTQHPAPPHHTGTQWQPVDPGRAAR PH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_997270 |
Locus ID | 388341 |
UniProt ID | Q8NAA5 |
Refseq Size | 2669 |
Cytogenetics | 17p11.2 |
Refseq ORF | 636 |
Synonyms | C17orf76; FAM211A |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404000 | LRRC75A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426437 | LRRC75A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404000 | Transient overexpression lysate of chromosome 17 open reading frame 76 (C17orf76), transcript variant 2 |
CNY 3,080.00 |
|
LY426437 | Transient overexpression lysate of chromosome 17 open reading frame 76 (C17orf76), transcript variant 1 |
CNY 3,080.00 |
|
PH317603 | C17orf76 MS Standard C13 and N15-labeled recombinant protein (NP_997270) |
CNY 19,520.00 |
|
PH325515 | C17orf76 MS Standard C13 and N15-labeled recombinant protein (NP_001107039) |
CNY 14,250.00 |
|
TP325515 | Recombinant protein of human chromosome 17 open reading frame 76 (C17orf76), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它C17orf76产品