SKAR (POLDIP3) (NM_178136) Human Recombinant Protein
CAT#: TP308957
Purified recombinant protein of Human polymerase (DNA-directed), delta interacting protein 3 (POLDIP3), transcript variant 2, 20 µg
View other "SKAR" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208957 representing NM_178136
Red=Cloning site Green=Tags(s) MADISLDELIRKRGAAAKGRLNARPGVGGVRSRVGIQQGLLSQSTRTATFQQRFDARQKIGLSDARLKLG VKDAREKLLQKDARFRIKGKVQDAREMLNSRKQQTTVPQKPRQVADAREKISLKRSSPAAFINPPIGTVT PALKLTKTIQNLYDLDEDDDGIASVPTKQMKFAASGGFLHHMAGLSSSKLSMSKALPLTKVVQNDAYTAP ALPSSIRTKALTNMSRTLVNKEEPPKELPAAEPVLSPLEGTKMTVNNLHPRVTEEDIVELFCVCGALKRA RLVHPGVAEVVFVKKDDAITAYKKYNNRCLDGQPMKCNLHMNGNVITSDQPILLRLSDSPSMKKESELPR RVNSASSSNPPAEVDPDTILKALFKSSGASVTTQPTEFKIKL myc-FLAG tag |
Tag | Myc-DDK |
Predicted MW | 42.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate Bradford method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_835237 |
Locus ID | 84271 |
UniProt ID | Q9BY77, Q9BY77-2 |
Refseq Size | 3348 |
Cytogenetics | 22q13.2 |
Refseq ORF | 1176 |
Synonyms | PDIP3; PDIP46; SKAR |
Summary | This gene encodes an RRM (RNA recognition motif)-containing protein that participates in the regulation of translation by recruiting ribosomal protein S6 kinase beta-1 to mRNAs. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410211 | POLDIP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410211 | Transient overexpression lysate of polymerase (DNA-directed), delta interacting protein 3 (POLDIP3), transcript variant 1 |
CNY 3,080.00 |
|
PH310583 | POLDIP3 MS Standard C13 and N15-labeled recombinant protein (NP_115687) |
CNY 14,250.00 |
|
TP310583 | Recombinant protein of human polymerase (DNA-directed), delta interacting protein 3 (POLDIP3), transcript variant 1, 20 µg |
CNY 2,900.00 |