PPP2R3C (NM_017917) Human Recombinant Protein
CAT#: TP301497
Recombinant protein of human protein phosphatase 2 (formerly 2A), regulatory subunit B'', gamma (PPP2R3C), 20 µg
View other "PPP2R3C" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201497 protein sequence
Red=Cloning site Green=Tags(s) MDWKEVLRRRLATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFYYRLPAEDEVL LQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINYENFLKVGEKAGAKCKQFFTA KVFAKLLHTDSYGRISIMQFFNYVMRKVWLHQTRIGLSLYDVAGQGYLRESDLENYILELIPTLPQLDGL EKSFYSFYVCTAVRKFFFFLDPLRTGKIKIQDILACSFLDDLLELRDEELSKESQETNWFSAPSALRVYG QYLNLDKDHNGMLSKEELSRYGTATMTNVFLDRVFQECLTYDGEMDYKTYLDFVLALENRKEPAALQYIF KLLDIENKGYLNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTV TTILIDLNGFWTYENREALVANDSENSADLDDT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060387 |
Locus ID | 55012 |
UniProt ID | Q969Q6 |
Refseq Size | 1843 |
Cytogenetics | 14q13.2 |
Refseq ORF | 1359 |
Synonyms | C14orf10; G4-1; G5pr; GDRM; SPGF36 |
Summary | This gene encodes a regulatory subunit of the serine/threonine phosphatase, protein phosphatase 2. This protein is localized to both nuclear and cytoplasmic regions depending on cell cycle phase. Homozygous conditional knockout mice for this gene exhibit reduced numbers and impaired proliferation of immune system B cells. This protein may regulate the expression of the P-glycoprotein ATP-binding cassette transporter through its phosphatase activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413446 | PPP2R3C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413446 | Transient overexpression lysate of protein phosphatase 2 (formerly 2A), regulatory subunit B'', gamma (PPP2R3C) |
CNY 3,080.00 |
|
PH301497 | PPP2R3C MS Standard C13 and N15-labeled recombinant protein (NP_060387) |
CNY 19,520.00 |
其它PPP2R3C产品