RBM18 (NM_033117) Human Recombinant Protein
CAT#: TP300878
Purified recombinant protein of Homo sapiens RNA binding motif protein 18 (RBM18), transcript variant 1, 20 µg
View other "RBM18" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200878 representing NM_033117
Red=Cloning site Green=Tags(s) MEAETKTLPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHKSGALEGQPRG YCFVNFETKQEAEQAIQCLNGKLALSKKLVVRWAHAQVKRYDHNKNDKILPISLEPSSSTEPTQSNLSVT AKIKAIEAKLKMMAENPDAEYPAAPVYSYFKPPDKKRTTPYSRTAWKSRR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_149108 |
Locus ID | 92400 |
UniProt ID | Q96H35 |
Refseq Size | 1087 |
Cytogenetics | 9q33.2 |
Refseq ORF | 570 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409722 | RBM18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409722 | Transient overexpression lysate of RNA binding motif protein 18 (RBM18), transcript variant 1 |
CNY 3,080.00 |
|
PH300878 | RBM18 MS Standard C13 and N15-labeled recombinant protein (NP_149108) |
CNY 14,250.00 |