NUDT5 (NM_014142) Human Recombinant Protein
CAT#: TP300204
Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 5 (NUDT5), 20 µg
View other "NUDT5" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200204 protein sequence
Red=Cloning site Green=Tags(s) MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQR TLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCT IHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAK PFEVPFLKF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_054861 |
Locus ID | 11164 |
UniProt ID | Q9UKK9 |
Refseq Size | 1224 |
Cytogenetics | 10p14 |
Refseq ORF | 657 |
Synonyms | hNUDT5; YSA1; YSA1H; YSAH1 |
Summary | This gene belongs to the Nudix (nucleoside diphosphate linked moiety X) hydrolase superfamily. The encoded enzyme catalyzes the hydrolysis of modified nucleoside diphosphates, including ADP-ribose (ADPR) and 8-oxoGua-containing 8-oxo-dADP and 8-oxo-dGDP. Protein-bound ADP ribose can be hazardous to the cell because it can modify some amino acid residues, resulting in the inhibition of ATP-activated potassium channels. 8-oxoGua is an oxidized form of guanine that can potentially alter genetic information by pairing with adenine and cytosine in RNA. Presence of 8-oxoGua in RNA results in formation of abnormal proteins due to translational errors. [provided by RefSeq, Aug 2013] |
Protein Pathways | Purine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415472 | NUDT5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415472 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 5 (NUDT5) |
CNY 3,080.00 |
|
PH300204 | NUDT5 MS Standard C13 and N15-labeled recombinant protein (NP_054861) |
CNY 19,520.00 |