C13orf31 (LACC1) (NM_001128303) Human Mass Spec Standard
CAT#: PH325705
C13orf31 MS Standard C13 and N15-labeled recombinant protein (NP_001121775)
View other "C13orf31" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | C13orf31 MS Standard C13 and N15-labeled recombinant protein (NP_001121775) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225705 |
Predicted MW | 47.8 kDa |
Protein Sequence |
>RC225705 protein sequence
Red=Cloning site Green=Tags(s) MAEAVLIDLFGLKLNSQKNCHQTLLKTLNAVQYHHAAKAKFLCIMCCSNISYERDGEQDNCEIETSNGLS ALLEEFEIVSCPSMAATLYTIKQKIDEKNLSSIKVIVPRHRKTLMKAFIDQLFTDVYNFEFEDLQVTFRG GLFKQSIEINVITAQELRGIQNEIETFLRSLPALRGKLTIITSSLIPDIFIHGFTTRTGGISYIPTLSSF NLFSSSKRRDPKVVVQENLRRLANAAGFNVEKFYRIKTHHSNDIWIMGRKEPDSYDGITTNQRGVTIAAL GADCIPIVFADPVKKACGVAHAGWKGTLLGVAMATVNAMIAEYGCSLEDIVVVLGPSVGPCCFTLPRESA EAFHNLHPACVQLFDSPNPCIDIRKATRILLEQGGILPQNIQDQNQDLNLCTSCHPDKFFSHVRDGLNFG TQIGFISIKE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001121775 |
RefSeq Size | 4288 |
RefSeq ORF | 1290 |
Synonyms | C13orf31; FAMIN; JUVAR |
Locus ID | 144811 |
Cytogenetics | 13q14.11 |
Summary | This gene encodes an oxidoreductase that promotes fatty-acid oxidation, with concomitant inflammasome activation, mitochondrial and NADPH-oxidase-dependent reactive oxygen species production, and bactericidal activity of macrophages. The encoded protein forms a complex with fatty acid synthase on peroxisomes and is thought to be modulated by peroxisome proliferator-activated receptor signaling events. Naturally occurring mutations in this gene are associated with inflammatory bowel disease, Behcet's disease, leprosy, ulcerative colitis, early-onset Crohn's disease, and systemic juvenile idiopathic arthritis. [provided by RefSeq, Apr 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407147 | LACC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426942 | LACC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407147 | Transient overexpression lysate of chromosome 13 open reading frame 31 (C13orf31), transcript variant 2 |
CNY 3,080.00 |
|
LY426942 | Transient overexpression lysate of chromosome 13 open reading frame 31 (C13orf31), transcript variant 1 |
CNY 3,080.00 |
|
PH307834 | C13orf31 MS Standard C13 and N15-labeled recombinant protein (NP_694950) |
CNY 19,520.00 |
|
TP307834 | Recombinant protein of human chromosome 13 open reading frame 31 (C13orf31), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP325705 | Recombinant protein of human chromosome 13 open reading frame 31 (C13orf31), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它C13orf31产品