C7orf50 (NM_001134396) Human Mass Spec Standard
CAT#: PH325216
C7orf50 MS Standard C13 and N15-labeled recombinant protein (NP_001127868)
View other "C7orf50" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | C7orf50 MS Standard C13 and N15-labeled recombinant protein (NP_001127868) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225216 |
Predicted MW | 22.1 kDa |
Protein Sequence |
>RC225216 protein sequence
Red=Cloning site Green=Tags(s) MAKQKRKVPEVTEKKNKKLKKASAEGPLLGPEAAPSGEGAGSKGEAVLRPGLDAEPELSPEEQRVLERKL KKERKKEERQRLREAGLVAQHPPARRSGAELALDYLCRWAQKHKNWRFQKTRQTWLLLHMYDSDKVPDEH FSTLLAYLEGLQGRARELTVQKAEALMRELDEEGSDPPLPGRAQRIRQVLQLLS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001127868 |
RefSeq Size | 1282 |
RefSeq ORF | 582 |
Synonyms | YCR016W |
Locus ID | 84310 |
Cytogenetics | 7p22.3 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410187 | C7orf50 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427414 | C7orf50 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427415 | C7orf50 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410187 | Transient overexpression lysate of chromosome 7 open reading frame 50 (C7orf50), transcript variant 1 |
CNY 3,080.00 |
|
LY427414 | Transient overexpression lysate of chromosome 7 open reading frame 50 (C7orf50), transcript variant 2 |
CNY 3,080.00 |
|
LY427415 | Transient overexpression lysate of chromosome 7 open reading frame 50 (C7orf50), transcript variant 3 |
CNY 3,080.00 |
|
PH302632 | C7orf50 MS Standard C13 and N15-labeled recombinant protein (NP_115726) |
CNY 19,520.00 |
|
PH325215 | C7orf50 MS Standard C13 and N15-labeled recombinant protein (NP_001127867) |
CNY 14,250.00 |
|
TP302632 | Recombinant protein of human chromosome 7 open reading frame 50 (C7orf50), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP325215 | Purified recombinant protein of Homo sapiens chromosome 7 open reading frame 50 (C7orf50), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP325216 | Recombinant protein of human chromosome 7 open reading frame 50 (C7orf50), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它C7orf50产品