TESC (NM_017899) Human Mass Spec Standard
CAT#: PH322650
TESC MS Standard C13 and N15-labeled recombinant protein (NP_060369)
View other "TESC" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | TESC MS Standard C13 and N15-labeled recombinant protein (NP_060369) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222650 |
Predicted MW | 24.6 kDa |
Protein Sequence |
>RC222650 representing NM_017899
Red=Cloning site Green=Tags(s) MGAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRSKIVRAFFDNR NLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFHMYDSDSDGRITLEEYRNVVE ELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNMETM ALCH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060369 |
RefSeq Size | 1025 |
RefSeq ORF | 642 |
Synonyms | CHP3; TSC |
Locus ID | 54997 |
Cytogenetics | 12q24.22 |
Summary | Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. Promotes the maturation, transport, cell surface stability and exchange activity of SLC9A1/NHE1 at the plasma membrane. Promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. Essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. Also involved in granulocytic differentiation in a ERK-dependent manner. Inhibits the phosphatase activity of calcineurin.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413481 | TESC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432652 | TESC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413481 | Transient overexpression lysate of tescalcin (TESC), transcript variant 1 |
CNY 3,080.00 |
|
LY432652 | Transient overexpression lysate of tescalcin (TESC), transcript variant 2 |
CNY 3,080.00 |
|
TP322650 | Recombinant protein of human tescalcin (TESC), 20 µg |
CNY 2,900.00 |