LCE3C (NM_178434) Human Mass Spec Standard
CAT#: PH321967
LCE3C MS Standard C13 and N15-labeled recombinant protein (NP_848521)
View other "LCE3C" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | LCE3C MS Standard C13 and N15-labeled recombinant protein (NP_848521) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221967 |
Predicted MW | 9.7 kDa |
Protein Sequence |
>RC221967 protein sequence
Red=Cloning site Green=Tags(s) MSCQQNQQQCQPPPSCPSPKCPPKSPAQCLPPPSSDCALSSGGCGPSSESGCCLSHHRHFRSHQCRRQRS NSCDRGSGQQGGGSCRGHGSGGCC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_848521 |
RefSeq Size | 425 |
RefSeq ORF | 282 |
Synonyms | LEP15; SPRL3A |
Locus ID | 353144 |
Cytogenetics | 1q21.3 |
Summary | A structural component of the cornified envelope of the stratum corneum involved in innate cutaneous host defense (Probable). Possesses defensin-like antimicrobial activity against a broad spectrum of Gram-positive and Gram-negative bacteria, both aerobic and anaerobic species. Upon inflammation, may regulate skin barrier repair by shaping cutaneous microbiota composition and immune response to bacterial antigens (PubMed:28634035).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405958 | LCE3C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405958 | Transient overexpression lysate of late cornified envelope 3C (LCE3C) |
CNY 3,080.00 |
|
TP321967 | Recombinant protein of human late cornified envelope 3C (LCE3C), 20 µg |
CNY 2,900.00 |