INS-IGF2 (NM_001042376) Human Mass Spec Standard
CAT#: PH320218
INS MS Standard C13 and N15-labeled recombinant protein (NP_001035835)
View other "INS-IGF2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | INS MS Standard C13 and N15-labeled recombinant protein (NP_001035835) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220218 |
Predicted MW | 21.4 kDa |
Protein Sequence |
>RC220218 representing NM_001042376
Red=Cloning site Green=Tags(s) MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQASALSLSS STSTWPEGLDATARAPPALVVTANIGQAGGSSSRQFRQRALGTSDSPVLFIHCPGAAGTAQGLEYRGRRV TTELVWEEVDSSPQPQGSESLPAQPPAQPAPQPEPQQAREPSPEVSCCGLWPRRPQRSQN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001035835 |
RefSeq Size | 828 |
RefSeq ORF | 600 |
Synonyms | INSIGF |
Locus ID | 723961 |
Cytogenetics | 11p15.5 |
Summary | This locus includes two alternatively spliced read-through transcript variants which align to the INS gene in the 5' region and to the IGF2 gene in the 3' region. One transcript is predicted to encode a protein which shares the N-terminus with the INS protein but has a distinct and longer C-terminus, whereas the other transcript is a candidate for nonsense-mediated decay (NMD). The transcripts are imprinted and are paternally expressed in the limb and eye. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420861 | INS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420861 | Transient overexpression lysate of INS-IGF2 readthrough transcript (INS-IGF2), transcript variant 2 |
CNY 3,080.00 |
|
TP320218 | Recombinant protein of human INS-IGF2 readthrough transcript (INS-IGF2), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它INS-IGF2产品