HOATZ (NM_207430) Human Mass Spec Standard
CAT#: PH317907
C11orf88 MS Standard C13 and N15-labeled recombinant protein (NP_997313)
View other "HOATZ" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | C11orf88 MS Standard C13 and N15-labeled recombinant protein (NP_997313) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217907 |
Predicted MW | 22.3 kDa |
Protein Sequence |
>RC217907 representing NM_207430
Red=Cloning site Green=Tags(s) METGPSEEPSGRKESQEMCPPGLLVFAGSSEQDANLAKQFWISASMYPPSESQLVLRRDSSQRLPVARPR RSRGSENSHSSQSFHLASNKNRDIFAEALKIQESEEKVKYLQKTRSHSVTQNEVQWHDHGSLQPQLSRIQ AKTREEILQLLRKQREERISKELISLPYKPKAKEHKAKKVVSESDKEDQEEVKTLD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_997313 |
RefSeq Size | 800 |
RefSeq ORF | 588 |
Synonyms | C11orf88 |
Locus ID | 399949 |
Cytogenetics | 11q23.1 |
Summary | Required for motile ciliogenesis and flagellar genesis by mediating the maturation of the glycolytic enzyme ENO4.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404031 | C11orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420240 | C11orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404031 | Transient overexpression lysate of chromosome 11 open reading frame 88 (C11orf88), transcript variant 1 |
CNY 3,080.00 |
|
LY420240 | Transient overexpression lysate of chromosome 11 open reading frame 88 (C11orf88), transcript variant 2 |
CNY 3,080.00 |
|
TP317907 | Recombinant protein of human chromosome 11 open reading frame 88 (C11orf88), transcript variant 1, 20 µg |
CNY 2,900.00 |