RAB1B (NM_030981) Human Mass Spec Standard
CAT#: PH309927
RAB1B MS Standard C13 and N15-labeled recombinant protein (NP_112243)
View other "RAB1B" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RAB1B MS Standard C13 and N15-labeled recombinant protein (NP_112243) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209927 |
Predicted MW | 22.2 kDa |
Protein Sequence |
>RC209927 protein sequence
Red=Cloning site Green=Tags(s) MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERF RTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFA DSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_112243 |
RefSeq Size | 1955 |
RefSeq ORF | 603 |
Locus ID | 81876 |
Cytogenetics | 11q13.2 |
Summary | Members of the RAB protein family, such as RAB1B, are low molecular mass monomeric GTPases localized on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB1B functions in the early secretory pathway and is essential for vesicle transport between the endoplasmic reticulum (ER) and Golgi (Chen et al., 1997 [PubMed 9030196]; Alvarez et al., 2003 [PubMed 12802079]).[supplied by OMIM, Jan 2009] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410580 | RAB1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410580 | Transient overexpression lysate of RAB1B, member RAS oncogene family (RAB1B) |
CNY 3,080.00 |
|
TP309927 | Recombinant protein of human RAB1B, member RAS oncogene family (RAB1B), 20 µg |
CNY 2,900.00 |