United States
Germany
Japan
United Kingdom
China
RFP2 (TRIM13) (NM_213590) Human Mass Spec Standard
CAT＃: PH309480
TRIM13 MS Standard C13 and N15-labeled recombinant protein (NP_998755)
View other "RFP2" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | TRIM13 MS Standard C13 and N15-labeled recombinant protein (NP_998755) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209480 |
| Predicted MW | 47 kDa |
| Protein Sequence |
>RC209480 protein sequence
Red=Cloning site Green=Tags(s) MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKETSATGINSLQ VNYSLKGIVEKYNKIKISPKMPVCKGHLGQPLNIFCLTDMQLICGICATRGEHTKHVFCSIEDAYAQERD AFESLFQSFETWRRGDALSRLDTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLA VMQAYDPEINKLNTILQEQRMAFNIAEAFKDVSEPIVFLQQMQEFREKIKVIKETPLPPSNLPASPLMKN FDTSQWEDIKLVDVDKLSLPQDTGTFISKIPWSFYKLFLLILLLGLVIVFGPTMFLEWSLFDDLATWKGC LSNFSSYLTKTADFIEQSVFYWEQVTDGFFIFNERFKNFTLVVLNNVAEFVCKYKLL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_998755 |
| RefSeq Size | 7311 |
| RefSeq ORF | 1222 |
| Synonyms | CAR; DLEU5; LEU5; RFP2; RNF77 |
| Locus ID | 10206 |
| Cytogenetics | 13q14.2 |
| Summary | This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This gene is located on chromosome 13 within the minimal deletion region for B-cell chronic lymphocytic leukemia. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403907 | TRIM13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409472 | TRIM13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417084 | TRIM13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423484 | TRIM13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429891 | TRIM13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403907 | Transient overexpression lysate of tripartite motif-containing 13 (TRIM13), transcript variant 3 |
CNY 3,080.00 |
|
| LY409472 | Transient overexpression lysate of tripartite motif-containing 13 (TRIM13), transcript variant 2 |
CNY 3,080.00 |
|
| LY417084 | Transient overexpression lysate of tripartite motif-containing 13 (TRIM13), transcript variant 1 |
CNY 3,080.00 |
|
| LY423484 | Transient overexpression lysate of tripartite motif-containing 13 (TRIM13), transcript variant 4 |
CNY 3,080.00 |
|
| TP309480 | Recombinant protein of human tripartite motif-containing 13 (TRIM13), transcript variant 3, 20 µg |
CNY 2,900.00 |
