RDHE2 (SDR16C5) (NM_138969) Human Mass Spec Standard
CAT#: PH306759
SDR16C5 MS Standard C13 and N15-labeled recombinant protein (NP_620419)
View other "RDHE2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SDR16C5 MS Standard C13 and N15-labeled recombinant protein (NP_620419) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206759 |
Predicted MW | 34.1 kDa |
Protein Sequence |
>RC206759 protein sequence
Red=Cloning site Green=Tags(s) MSFNLQSSKKLFIFLGKSLFSLLEAMIFALLPKPRKNVAGEIVLITGAGSGLGRLLALQFARLGSVLVLW DINKEGNEETCKMAREAGATRVHAYTCDCSQKEGVYRVADQVKKEVGDVSILINNAGIVTGKKFLDCPDE LMEKSFDVNFKAHLWTYKAFLPAMIANDHGHLVCISSSAGLSGVNGLADYCASKFAAFGFAESVFVETFV QKQKGIKTTIVCPFFIKTGMFEGCTTGCPSLLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSF LPLKTGLLIADYLGILHAMDGFVDQKKKL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_620419 |
RefSeq Size | 3039 |
RefSeq ORF | 927 |
Synonyms | EPHD-2; RDH#2; RDH-E2; RDHE2; retSDR2 |
Locus ID | 195814 |
Cytogenetics | 8q12.1 |
Summary | This gene encodes a member of the short-chain alcohol dehydrogenase/reductase superfamily of proteins and is involved in the oxidation of retinol to retinaldehyde. The encoded protein is associated with the endoplasmic reticulum and is predicted to contain three transmembrane helices, suggesting that it is an integral membrane protein. It recognizes all-trans-retinol and all-trans-retinaldehyde as substrates and exhibits a strong preference for NAD(+)/NADH as cofactors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408444 | SDR16C5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408444 | Transient overexpression lysate of short chain dehydrogenase/reductase family 16C, member 5 (SDR16C5) |
CNY 3,080.00 |
|
TP306759 | Recombinant protein of human short chain dehydrogenase/reductase family 16C, member 5 (SDR16C5), 20 µg |
CNY 2,900.00 |