HPCAL4 (NM_016257) Human Mass Spec Standard
CAT#: PH305253
HPCAL4 MS Standard C13 and N15-labeled recombinant protein (NP_057341)
View other "HPCAL4" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | HPCAL4 MS Standard C13 and N15-labeled recombinant protein (NP_057341) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205253 |
Predicted MW | 22.2 kDa |
Protein Sequence |
>RC205253 protein sequence
Red=Cloning site Green=Tags(s) MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFR TFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRM NQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDASIVLLLQCDMQK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057341 |
RefSeq Size | 4895 |
RefSeq ORF | 573 |
Synonyms | HLP4 |
Locus ID | 51440 |
Cytogenetics | 1p34.2 |
Summary | The protein encoded by this gene is highly similar to human hippocalcin protein and hippocalcin like-1 protein. It also has similarity to rat neural visinin-like Ca2+-binding protein-type 1 and 2 proteins. This encoded protein may be involved in the calcium-dependent regulation of rhodopsin phosphorylation. The transcript of this gene has multiple polyadenylation sites. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414097 | HPCAL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414097 | Transient overexpression lysate of hippocalcin like 4 (HPCAL4) |
CNY 3,080.00 |
|
TP305253 | Recombinant protein of human hippocalcin like 4 (HPCAL4), 20 µg |
CNY 2,900.00 |