TPMT (NM_000367) Human Mass Spec Standard
CAT#: PH303309
TPMT MS Standard C13 and N15-labeled recombinant protein (NP_000358)
View other "TPMT" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | TPMT MS Standard C13 and N15-labeled recombinant protein (NP_000358) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203309 |
Predicted MW | 28.2 kDa |
Protein Sequence |
>RC203309 protein sequence
Red=Cloning site Green=Tags(s) MDGTRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLC GKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPR TNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGK ICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTEK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000358 |
RefSeq Size | 3281 |
RefSeq ORF | 735 |
Synonyms | TPMTD |
Locus ID | 7172 |
Cytogenetics | 6p22.3 |
Summary | This gene encodes the enzyme that metabolizes thiopurine drugs via S-adenosyl-L-methionine as the S-methyl donor and S-adenosyl-L-homocysteine as a byproduct. Thiopurine drugs such as 6-mercaptopurine are used as chemotherapeutic agents. Genetic polymorphisms that affect this enzymatic activity are correlated with variations in sensitivity and toxicity to such drugs within individuals, causing thiopurine S-methyltransferase deficiency. Related pseudogenes have been identified on chromosomes 3, 18 and X. [provided by RefSeq, Aug 2014] |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - other enzymes |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400131 | TPMT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400131 | Transient overexpression lysate of thiopurine S-methyltransferase (TPMT) |
CNY 3,080.00 |
|
TP303309 | Recombinant protein of human thiopurine S-methyltransferase (TPMT), 20 µg |
CNY 2,900.00 |