SNAPIN (NM_012437) Human Mass Spec Standard
CAT#: PH302602
SNAPIN MS Standard C13 and N15-labeled recombinant protein (NP_036569)
View other "SNAPIN" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SNAPIN MS Standard C13 and N15-labeled recombinant protein (NP_036569) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202602 |
Predicted MW | 14.9 kDa |
Protein Sequence |
>RC202602 protein sequence
Red=Cloning site Green=Tags(s) MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINE DQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036569 |
RefSeq Size | 1052 |
RefSeq ORF | 408 |
Synonyms | BLOC1S7; BLOS7; BORCS3; SNAPAP |
Locus ID | 23557 |
Cytogenetics | 1q21.3 |
Summary | The protein encoded by this gene is a coiled-coil-forming protein that associates with the SNARE (soluble N-ethylmaleimide-sensitive fusion protein attachment protein receptor) complex of proteins and the BLOC-1 (biogenesis of lysosome-related organelles) complex. Biochemical studies have identified additional binding partners. As part of the SNARE complex, it is required for vesicle docking and fusion and regulates neurotransmitter release. The BLOC-1 complex is required for the biogenesis of specialized organelles such as melanosomes and platelet dense granules. Mutations in gene products that form the BLOC-1 complex have been identified in mouse strains that are models of Hermansky-Pudlak syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415762 | SNAPIN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415762 | Transient overexpression lysate of SNAP-associated protein (SNAPIN) |
CNY 3,080.00 |
|
TP302602 | Recombinant protein of human SNAP-associated protein (SNAPIN), 20 µg |
CNY 2,900.00 |