ICAM4 (NM_001039132) Human Mass Spec Standard
CAT#: PH300636
ICAM4 MS Standard C13 and N15-labeled recombinant protein (NP_001034221)
View other "ICAM4" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ICAM4 MS Standard C13 and N15-labeled recombinant protein (NP_001034221) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200636 |
Predicted MW | 29.6 kDa |
Protein Sequence |
>RC200636 protein sequence
Red=Cloning site Green=Tags(s) MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCS NSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYSVPGGLLGG DPEAWKPGHLFRKPGALHRPGSGQRDLDLRVCCWTPRLLAARDLPRAPQSRRPGGPQQLGTHYTDARLEP RAHSFGLRFHRCPCRDPPHCGRCVPMQVPSYEVPGVKGDVLCRLSEKKRNMKQSGEMAIHGG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001034221 |
RefSeq Size | 1277 |
RefSeq ORF | 816 |
Synonyms | CD242; LW |
Locus ID | 3386 |
Cytogenetics | 19p13.2 |
Summary | This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. This ICAM protein contains 2 Ig-like C2-type domains and binds to the leukocyte adhesion LFA-1 protein. The molecular basis of the LW(A)/LW(B) blood group antigens is a single aa variation at position 100; Gln-100=LW(A) and Arg-100=LW(B). Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411697 | ICAM4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419874 | ICAM4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422020 | ICAM4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411697 | Transient overexpression lysate of intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) (ICAM4), transcript variant 2 |
CNY 3,080.00 |
|
LY419874 | Transient overexpression lysate of intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) (ICAM4), transcript variant 1 |
CNY 3,080.00 |
|
LY422020 | Transient overexpression lysate of intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) (ICAM4), transcript variant 3 |
CNY 3,080.00 |
|
TP300636 | Recombinant protein of human intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) (ICAM4), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP761371 | Purified recombinant protein of Human intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) (ICAM4), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |