FAM32A (NM_014077) Human Mass Spec Standard
CAT#: PH300334
FAM32A MS Standard C13 and N15-labeled recombinant protein (NP_054796)
View other "FAM32A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | FAM32A MS Standard C13 and N15-labeled recombinant protein (NP_054796) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200334 |
Predicted MW | 13.2 kDa |
Protein Sequence |
>RC200334 protein sequence
Red=Cloning site Green=Tags(s) MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQE KRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_054796 |
RefSeq Size | 1464 |
RefSeq ORF | 336 |
Synonyms | OTAG-12; OTAG12 |
Locus ID | 26017 |
Cytogenetics | 19p13.11 |
Summary | Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. May also increase cell sensitivity to apoptotic stimuli.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415497 | FAM32A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415497 | Transient overexpression lysate of family with sequence similarity 32, member A (FAM32A) |
CNY 3,080.00 |
|
TP300334 | Recombinant protein of human family with sequence similarity 32, member A (FAM32A), 20 µg |
CNY 2,900.00 |