Gastrin Releasing Peptide (GRP) (NM_002091) Human Tagged ORF Clone
CAT#: RC202542
GRP (Myc-DDK-tagged)-Human gastrin-releasing peptide (GRP), transcript variant 1
ORF Plasmid: tGFP
"NM_002091" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 3 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | BN; GRP-10; preproGRP; proGRP |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC202542 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCGCGGCCGTGAGCTCCCGCTGGTCCTGCTGGCGCTGGTCCTCTGCCTGGCGCCCCGGGGGCGAGCGG TCCCGCTGCCTGCGGGCGGAGGGACCGTGCTGACCAAGATGTACCCGCGCGGCAACCACTGGGCGGTGGG GCACTTAATGGGGAAAAAGAGCACAGGGGAGTCTTCTTCTGTTTCTGAGAGAGGGAGCCTGAAGCAGCAG CTGAGAGAGTACATCAGGTGGGAAGAAGCTGCAAGGAATTTGCTGGGTCTCATAGAAGCAAAGGAGAACA GAAACCACCAGCCACCTCAACCCAAGGCCCTGGGCAATCAGCAGCCTTCGTGGGATTCAGAGGATAGCAG CAACTTCAAAGATGTAGGTTCAAAAGGCAAAGTTGGTAGACTCTCTGCTCCAGGTTCTCAACGTGAAGGA AGGAACCCCCAGCTGAACCAGCAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC202542 protein sequence
Red=Cloning site Green=Tags(s) MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQ LREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREG RNPQLNQQ myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_002091 |
ORF Size | 444 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002091.5 |
RefSeq Size | 863 bp |
RefSeq ORF | 447 bp |
Locus ID | 2922 |
UniProt ID | P07492 |
Protein Families | Secreted Protein |
MW | 16.2 kDa |
Gene Summary | This gene encodes a member of the bombesin-like family of gastrin-releasing peptides. The encoded preproprotein is proteolytically processed to generate two peptides, gastrin-releasing peptide and neuromedin-C. These peptides regulate numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation. These peptides are also likely to play a role in human cancers of the lung, colon, stomach, pancreas, breast, and prostate. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016] |
Citations (3)
The use of this cDNA Clones has been cited in the following citations: |
---|
Magnetic Synthetic Receptors for Selective Clean-Up in Protein Biomarker Quantification
,McKitterick, N;Braathen, F;Switnicka-Plak, MA;Cormack, PAG;Reubsaet, L;Halvorsen, TG;,
J. Proteome Res.
,PubMed ID 32614597
[Gastrin Releasing Peptide]
|
Immunocapture sample clean-up in determination of low abundant protein biomarkers–a feasibility study of peptide capture by anti-protein antibodies
,Levernæs, MCS;Farhat, B;Oulie, I;Abdullah, SS;,
RSC Advances
[Gastrin Releasing Peptide]
|
Epitope Fishing in Digested Biological Samples
,Levernæs, M;Farhat, B;Oulie, I;Abdullah, S;Paus, E;Reubsaet, L;Halvorsen, T;,
ChemRxiv
[Gastrin Releasing Peptide]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC202542L1 | Lenti ORF clone of Human gastrin-releasing peptide (GRP), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC202542L2 | Lenti ORF clone of Human gastrin-releasing peptide (GRP), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC202542L3 | Lenti ORF clone of Human gastrin-releasing peptide (GRP), transcript variant 1, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC202542L4 | Lenti ORF clone of Human gastrin-releasing peptide (GRP), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RG202542 | GRP (tGFP-tagged) - Human gastrin-releasing peptide (GRP), transcript variant 1 |
CNY 4,370.00 |
|
SC122618 | GRP (untagged)-Human gastrin-releasing peptide (GRP), transcript variant 1 |
CNY 1,200.00 |
其它Gastrin Releasing Peptide产品