Rab5a (BC004842) Mouse Tagged ORF Clone

CAT#: MR202370

  • TrueORF®

Rab5a (Myc-DDK-tagged) - Mouse RAB5A, member RAS oncogene family (cDNA clone MGC:6509 IMAGE:2649317)

ORF Plasmid: DDK tGFP



  "BC004842" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,400.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Rab5a Antibody - C-terminal region
    • 50 ug

CNY 4,628.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 2410015H04Rik; AI663973; AU021172; nnyRab5a
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR202370 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTAATCGAGGAGCAACAAGACCCAACGGGCCAAATACTGGAAATAAAATATGCCAGTTCAAACTGG
TCCTTCTAGGAGAGTCTGCTGTTGGCAAATCAAGCCTGGTTCTTCGCTTTGTGAAAGGCCAATTTCATGA
ATTTCAAGAGAGTACCATTGGGGCTGCCTTTCTAACCCAAACTGTGTGTCTTGATGACACAACAGTAAAA
TTTGAAATATGGGATACAGCTGGTCAAGAACGGTATCATAGCTTAGCACCAATGTACTACCGAGGAGCAC
AAGCAGCCATAGTTGTGTATGATATCACAAATGAGGAATCCTTTGCGAGAGCAAAAAACTGGGTTAAAGA
ACTTCAAAGGCAAGCAAGTCCTAATATTGTGATAGCTTTGTCAGGAAACAAAGCTGACTTAGCAAATAAA
AGAGCTGTTGACTTCCAGGAAGCACAGTCCTATGCAGATGACAACAGCTTATTATTTATGGAGACATCAG
CTAAGACATCAATGAATGTAAATGAAATATTTATGGCAATAGCTAAAAAGCTGCCAAAGAATGAACCACA
GAATCCTGGTGCAAACTCAGCCAGAGGACGAGGAGTAGACCTTACTGAGCCTGCACAGCCAGCCAGAAGC
CAGTGTTGTAGTAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR202370 protein sequence
Red=Cloning site Green=Tags(s)

MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVK
FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANK
RAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPAQPARS
QCCSN

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC004842
ORF Size 645 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC004842.1
RefSeq Size 2246 bp
RefSeq ORF 647 bp
Locus ID 271457
MW 23.6 kDa
Gene Summary The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB5A is required for the fusion of plasma membranes and early endosomes. Contributes to the regulation of filopodia extension. Required for the exosomal release of SDCBP, CD63, PDCD6IP and syndecan (By similarity). Regulates maturation of apoptotic cell-containing phagosomes, probably downstream of DYN2 and PIK3C3 (PubMed:18425118).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...