CDC25B Rabbit Polyclonal Antibody
CAT#: TA346010
Rabbit Polyclonal Anti-Cdc25b Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Cdc25b antibody is synthetic peptide directed towards the middle region of Mouse Cdc25b. Synthetic peptide located within the following region: KEEEQDLIMFSKCQRLFRSPSMPCSVIRPILKRLERPQDRDVPVQSKRRK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 65 kDa |
Gene Name | cell division cycle 25B |
Database Link | |
Background | Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression. It is required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner and directly dephosphorylates CDK1 and stimulates its kinase activity. |
Synonyms | cell division cycle 25 homolog B (S. pombe); cell division cycle 25B; OTTHUMP00000030137; OTTHUMP00000030138; OTTHUMP00000030139 |
Note | Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Rat: 86%; Horse: 86%; Mouse: 86%; Dog: 79%; Pig: 79%; Guinea pig: 79% |
Reference Data | |
Protein Families | Druggable Genome, Phosphatase |
Protein Pathways | Cell cycle, MAPK signaling pathway, Progesterone-mediated oocyte maturation |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |