ZSCAN16 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZSCAN16 antibody: synthetic peptide directed towards the C terminal of human ZSCAN16. Synthetic peptide located within the following region: KDFSGRTGLIQHQRIHTGEKPYECDECGRPFRVSSALIRHQRIHTANKLY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	zinc finger and SCAN domain containing 16
Database Link	NP_079507 Entrez Gene 80345 Human UniProt ID Q9H4T2
Background	ZSCAN16 may be involved in transcriptional regulation.
Synonyms	dJ265C24.3; ZNF392; ZNF435
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 86%; Rat: 79%; Goat: 79%; Mouse: 79%; Guinea pig: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.