CHCHD8 (COA4) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CHCHD8 antibody: synthetic peptide directed towards the middle region of human CHCHD8. Synthetic peptide located within the following region: SHFAVQECMAQHQDWRQCQPQVQAFKDCMSEQQARRQEELQRRQEQAGAH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	10 kDa
Gene Name	cytochrome c oxidase assembly factor 4 homolog
Database Link	NP_057649 Entrez Gene 51287 Human UniProt ID Q9NYJ1
Background	The function of CHCHD8 remains unknown.
Synonyms	CHCHD8; CMC3; E2IG2
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Rabbit: 83%; Horse: 79%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.