PDP2 Rabbit Polyclonal Antibody
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PDP2 antibody: synthetic peptide directed towards the middle region of human PDP2. Synthetic peptide located within the following region: LQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 60 kDa |
Gene Name | pyruvate dehyrogenase phosphatase catalytic subunit 2 |
Database Link | |
Background | PDP2 catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex. |
Synonyms | PDPC 2; PPM2B; PPM2C2 |
Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Rabbit: 92%; Guinea pig: 92%; Zebrafish: 85% |
Reference Data | |
Protein Families | Druggable Genome, Phosphatase |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |