C4orf19 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C4orf19 antibody: synthetic peptide directed towards the N terminal of human C4orf19. Synthetic peptide located within the following region: MGCRCCKIIQSYLFDPVQVPSPGYVNEVNSCKLDEDDTDKLKGKWSSEVL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	chromosome 4 open reading frame 19
Database Link	NP_060772 Entrez Gene 55286 Human UniProt ID Q8IY42
Background	The function of C4orf19 remains unknown.
Synonyms	FLJ11017
Note	Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.