CEACAM7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CEACAM7 antibody: synthetic peptide directed towards the C terminal of human CEACAM7. Synthetic peptide located within the following region: FSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	carcinoembryonic antigen related cell adhesion molecule 7
Database Link	NP_008821 Entrez Gene 1087 Human UniProt ID Q14002
Background	The function of CEACAM7 remains unknow.
Synonyms	CGM2
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Pig: 92%; Guinea pig: 92%; Bovine: 79%; Rabbit: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.