Thrb Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB, ChIP
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Thrb antibody: synthetic peptide directed towards the n terminal of mouse Thrb. Synthetic peptide located within the following region: MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54
Gene Name	thyroid hormone receptor beta
Database Link	NP_033406 Entrez Gene 21834 Mouse UniProt ID P37242
Background	Nuclear hormone receptor that can act as a repressor or activator of transcription. High affinity receptor for thyroid hormones, including triiodothyronine and thyroxine.
Synonyms	ERBA-BETA; ERBA2; GRTH; MGC126109; MGC126110; NR1A2; OTTHUMP00000208475; OTTHUMP00000208531; PRTH; THR1; THRB1; THRB2
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.