Lyl1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Lyl1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Lyl1. Synthetic peptide located within the following region: GVEGNARCGAGHRVEAARSQPVLPGDCDGDPNGSVRPIKMEQTALSPEVR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	lymphoblastic leukemia associated hematopoiesis regulator 1
Database Link	NP_001007678 Entrez Gene 304663 Rat UniProt ID Q66HH3
Background	The function ofThis protein remains unknown.
Synonyms	bHLHa18
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.