GJC1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GJC1 antibody: synthetic peptide directed towards the middle region of human GJC1. Synthetic peptide located within the following region: ERLDLAVQAYSHQNNPHGPREKKAKVGSKAGSNKSTASSKSGDGKTSVWI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	gap junction protein gamma 1
Database Link	NP_005488 Entrez Gene 10052 Human UniProt ID P36383
Background	This gene is a member ofThe connexin gene family.The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route forThe diffusion of low molecular weight materials from cell to cell. Alternatively spliced transcript variants encodingThe same isoform have been described. [provided by RefSeq, Jul 2008]
Synonyms	CX45; GJA7
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 80%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families	Ion Channels: Other, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.