SNX18 Rabbit Polyclonal Antibody
CAT#: TA340215
Rabbit Polyclonal Anti-SNX18 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SNAG1 antibody: synthetic peptide directed towards the N terminal of human SNAG1. Synthetic peptide located within the following region: LLQPQQAPPPSTFQPPGAGFPYGGGALQPSPQQLYGGYQASQGSDDDWDD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 69 kDa |
Gene Name | sorting nexin 18 |
Database Link | |
Background | This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like |
Synonyms | SH3PX2; SH3PXD3B; SNAG1 |
Note | Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Bovine: 88%; Dog: 80%; Yeast: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |