CHAD Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CHAD antibody: synthetic peptide directed towards the middle region of human CHAD. Synthetic peptide located within the following region: LSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	chondroadherin
Database Link	NP_001258 Entrez Gene 1101 Human UniProt ID O15335
Background	Chondroadherin is a cartilage matrix protein thought to mediate adhesion of isolated chondrocytes. CHAD contains 11 leucine-rich repeats flanked by cysteine-rich regions. The chondroadherin messenger RNA is present in chondrocytes at all ages. Chondroadherin is a cartilage matrix protein thought to mediate adhesion of isolated chondrocytes. The protein contains 11 leucine-rich repeats flanked by cysteine-rich regions. The chondroadherin messenger RNA is present in chondrocytes at all ages.
Synonyms	SLRR4A
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data
Protein Families	Secreted Protein
Protein Pathways	ECM-receptor interaction, Focal adhesion

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.