FAM62C (ESYT3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FAM62C antibody: synthetic peptide directed towards the N terminal of human FAM62C. Synthetic peptide located within the following region: RNRRGKLGRLAAAFEFLDNEREFISRELRGQHLPAWIHFPDVERVEWANK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	100 kDa
Gene Name	extended synaptotagmin protein 3
Database Link	NP_114119 Entrez Gene 83850 Human UniProt ID A0FGR9
Background	ESYT3 belongs to the extended synaptotagmin family. It is a single-pass membrane protein, and contains 3 C2 domains. ESYT3 may play a role as calcium-regulated intrinsic membrane protein.
Synonyms	CHR3SYT; E-Syt3; FAM62C
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 86%; Rabbit: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.