LRRC48 (DRC3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-LRRC48 antibody is: synthetic peptide directed towards the C-terminal region of Human LRRC48. Synthetic peptide located within the following region: NIFEYGLKQQEKRKTELDTFSECVREAIQENQEQGKRKIAKFEEKHLSLF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	dynein regulatory complex subunit 3
Database Link	NP_112584 Entrez Gene 83450 Human UniProt ID Q9H069
Background	The function of this protein remains unknown.
Synonyms	CFAP134; LRRC48
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Bovine: 93%; Rabbit: 92%; Dog: 86%; Rat: 86%; Pig: 85%; Guinea pig: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.