ASH2L Rabbit Polyclonal Antibody
CAT#: TA335740
Rabbit Polyclonal Anti-ASH2L Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,537.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ASH2L Antibody: synthetic peptide directed towards the N terminal of human ASH2L. Synthetic peptide located within the following region: EPSSGEAEGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 69 kDa |
Gene Name | ASH2 like histone lysine methyltransferase complex subunit |
Database Link | |
Background | ASH2L plays a role in hematopoiesis and is associated with some special kinds of leukemia. The amount of ASH2L transcripts is extremely high in fetal liver, testis, and leukemia cell lines with erythroid and megakaryocytic potential. |
Synonyms | ASH2; ASH2L1; ASH2L2; Bre2 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 93% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |