TEX14 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TEX14 Antibody: synthetic peptide directed towards the middle region of human TEX14. Synthetic peptide located within the following region: TPDGEYFYSSTAQENLALETSSPIEEDFEGIQGAFAQPQVSGEEKFQMRK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	164 kDa
Gene Name	testis expressed 14, intercellular bridge forming factor
Database Link	NP_938207 Entrez Gene 56155 Human UniProt ID Q8IWB6
Background	TEX14 belongs to the protein kinase superfamily. It contains 3 ANK repeats and 1 protein kinase domain. TEX14 is required for spermatogenesis and male fertility. It may be required for normal structure of the intercellular bridge that connects spermatocytes and spermatogonia. It has no protein kinase activity.
Synonyms	CT113
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 86%; Pig: 85%; Horse: 82%; Dog: 79%; Rat: 79%; Rabbit: 79%
Reference Data
Protein Families	Protein Kinase

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.