SERPINA11 Rabbit Polyclonal Antibody

CAT#: TA334832

Rabbit Polyclonal Anti-SERPINA11 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 11 (SERPINA11)
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 11 (SERPINA11), 20 µg
    • 20 ug

CNY 2,900.00


Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 11 (SERPINA11), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SERPINA11 antibody is: synthetic peptide directed towards the middle region of Human SERPINA11. Synthetic peptide located within the following region: TFMVLANYIFFKAKWKHPFSRYQTQKQESFFVDERTSLQVPMMHQKEMHR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 47 kDa
Gene Name serpin family A member 11
Background The function of this protein remains unknown.
Synonyms antiproteinase-like 2; antitrypsin); clade A (alpha-1 antiproteinase; member 11; serine (or cysteine) proteinase inhibitor; serpin peptidase inhibitor
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 93%; Bovine: 93%; Pig: 86%; Rat: 86%; Mouse: 86%; Guinea pig: 83%; Rabbit: 79%
Reference Data
Protein Families Druggable Genome, Secreted Protein
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...