PSMB11 Rabbit Polyclonal Antibody
CAT#: TA334356
Rabbit Polyclonal Anti-PSMB11 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PSMB11 antibody is: synthetic peptide directed towards the C-terminal region of Human PSMB11. Synthetic peptide located within the following region: HVRESGWEHVSRSDACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAED |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 33 kDa |
Gene Name | proteasome subunit beta 11 |
Database Link | |
Background | Proteasomes generate peptides that are presented by major histocompatibility complex (MHC) I molecules to other cells of the immune system. Proteolysis is conducted by 20S proteasomes, complexes of 28 subunits arranged as a cylinder in 4 heteroheptameric rings: alpha-1 to -7, beta-1 to -7, beta-1 to -7, and alpha-1 to -7. The catalytic subunits are beta-1, beta-2), and beta-5 (PSMB5; MIM 600306). Three additional subunits, beta-1i, beta-2i, and beta-5i, are induced by gamma-interferon and are preferentially incorporated into proteasomes to make immunoproteasomes. PSMB11, or beta-5t, is a catalytic subunit expressed exclusively in cortical thymic epithelial cells . |
Synonyms | BETA5T |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 83% |
Reference Data | |
Protein Pathways | Proteasome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |