SPINK6 Rabbit Polyclonal Antibody
CAT#: TA333313
Rabbit Polyclonal Anti-SPINK6 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SPINK6 Antibody: synthetic peptide directed towards the middle region of human SPINK6. Synthetic peptide located within the following region: GEFQDPKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKHPGKC |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 8 kDa |
Gene Name | serine peptidase inhibitor, Kazal type 6 |
Database Link | |
Background | The protein encoded by this gene is a Kazal-type serine protease inhibitor that acts on kallikrein-related peptidases in the skin. Two transcript variants the same protein have been found for this gene. |
Synonyms | BUSI2; UNQ844 |
Note | Immunogen sequence homology: Human: 100%; Pig: 93%; Dog: 85%; Horse: 85%; Bovine: 85%; Guinea pig: 85% |
Reference Data | |
Protein Families | Secreted Protein, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |