KDM4C Rabbit Polyclonal Antibody
CAT#: TA332172
Rabbit Polyclonal Anti-JMJD2C Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-JMJD2C Antibody: synthetic peptide directed towards the middle region of human JMJD2C. Synthetic peptide located within the following region: CLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 89 kDa |
Gene Name | lysine demethylase 4C |
Database Link | |
Background | JMJD2C is a member of the Jumonji domain 2 (JMJD2) family. It contains one JmjC domain, one JmjN domain, two PHD-type zinc fingers, and two Tudor domains. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form. Chromosomal aberrations and increased transcriptional expression of this gene are associated with esophageal squamous cell carcinoma. |
Synonyms | GASC1; JHDM3C; JMJD2C; TDRD14C |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |