DRIL1 (ARID3A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ARID3A Antibody: synthetic peptide directed towards the middle region of human ARID3A. Synthetic peptide located within the following region: QAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	63 kDa
Gene Name	AT-rich interaction domain 3A
Database Link	NP_005215 Entrez Gene 1820 Human UniProt ID Q99856
Background	ARID3A is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It was found by its homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.
Synonyms	BRIGHT; DRIL1; DRIL3; E2FBP1
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Horse: 92%; Guinea pig: 92%; Zebrafish: 77%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.