TEX14 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Tex35 Antibody is: synthetic peptide directed towards the middle region of Human Tex35. Synthetic peptide located within the following region: LINTQKNYKLPLRRAPKEQQELRLMGKTHREPQLRPKKMDGASGVNGAPC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	19 kDa
Gene Name	testis expressed 14, intercellular bridge forming factor
Database Link	NP_112562 Entrez Gene 56155 Human UniProt ID Q8IWB6
Background	The function of this protein remains unknown.
Synonyms	CT113
Note	Immunogen sequence homology: Human: 100%; Dog: 92%; Horse: 85%; Rat: 83%; Rabbit: 77%
Reference Data
Protein Families	Protein Kinase

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.