BAZ1A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-BAZ1A antibody: synthetic peptide directed towards the middle region of human BAZ1A. Synthetic peptide located within the following region: SLPKRGRPQVRLPVKTRGKLSSSFSSRGQQQEPGRYPSRSQQSTPKTTVS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	179 kDa
Gene Name	bromodomain adjacent to zinc finger domain 1A
Database Link	NP_038476 Entrez Gene 11177 Human UniProt ID Q9NRL2
Background	BAZ1A may play a role in transcriptional regulation. May be involved in the formation or maintenance of heterochromatin playing a critical role in developmental control.
Synonyms	ACF1; hACF1; WALp1; WCRF180
Note	Human: 100%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Dog: 85%; Pig: 85%; Horse: 85%; Bovine: 85%; Guinea pig: 85%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.