Homeobox protein SIX6 (SIX6) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SIX6 antibody: synthetic peptide directed towards the N terminal of human SIX6. Synthetic peptide located within the following region: PAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQAL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	SIX homeobox 6
Database Link	NP_031400 Entrez Gene 4990 Human UniProt ID O95475
Background	SIX6 is a member of SIX family. It is the homologue of the chick Six6(Optx2) gene. SIX6 is closely related to SIX3 and is expressed in the developing and adult human retina.
Synonyms	MCOPCT2; ODRMD; OPTX2; Six9
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.